PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT18851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 347aa    MW: 38326.6 Da    PI: 4.7752
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT18851genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.25.8e-27204253352
    RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
               ++i +e+l+ yF++pi++AA+e++v+lTvLK++CR++G++RWPhRk+ksl
  EMT18851 204 DHIGFEELRTYFYMPITKAAREMNVGLTVLKKRCRELGVARWPHRKMKSL 253
               6899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.189189275IPR003035RWP-RK domain
PfamPF020424.2E-21206253IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MEMQQQYFGG DGDADWFHQL ALLPPLPISS SLPPLPMRPE EQMSCLPMNP SPAVVDDVYS  60
SYAPNNVDVL PPFPAGLDDP TAGLDDALLM ESFSDIDLEE FADAVGHKIK TEPLDDAMVP  120
ADHDFAAQAQ QACPVVIMNQ QQLNAPRDVR LLIDPDDDDS TVVAGGYEAA AVGCAEQKQV  180
RPAPRRVRKS SGGARPAAGG KSLDHIGFEE LRTYFYMPIT KAAREMNVGL TVLKKRCREL  240
GVARWPHRKM KSLRSLILNI QEMGKGATSP AAVQGELEAL ERYCAIMEEN PAIELTEQTK  300
KLRQACFKEN YKRRRAAASV NLLDHCYNDL ASHEQQMPLP QMGFFGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7149460.0JF714946.1 Triticum aestivum cultivar Bobwhite RWP-RK domain containing protein (RKD1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233419.14e-81PREDICTED: uncharacterized protein LOC104583278
TrEMBLR7W9U00.0R7W9U0_AEGTA; Uncharacterized protein
STRINGBRADI2G40920.11e-80(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128882330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.17e-38RWP-RK domain-containing protein